EIF2B1 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2293282
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human EIF2B1 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: EIF2B1 (NP_001405.1, 1 a.a. ~ 305 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
• NCBI: NP_001405.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

EIF2B1 MaxPab polyclonal antibody. Western Blot analysis of EIF2B1 expression in human colon.

Western Blot analysis of EIF2B1 expression in transfected 293T cell line by EIF2B1 MaxPab polyclonal antibody. Lane 1: EIF2B1 transfected lysate (33.55 KDa). Lane 2: Non-transfected lysate.