EIF2AK2 monoclonal antibody (M02), clone 1D11

• Catalog Number: orb2292337
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EIF2AK2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1D11
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: EIF2AK2 (NP_002750, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGN
• NCBI: NP_002750
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EIF2AK2 is approximately 0.03 ng/ml as a capture antibody.

EIF2AK2 monoclonal antibody (M02), clone 1D11 Western Blot analysis of EIF2AK2 expression in K-562.

Immunofluorescence of monoclonal antibody to EIF2AK2 on HeLa cell. [antibody concentration 30 ug/ml]

Immunoperoxidase of monoclonal antibody to EIF2AK2 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 1.5 ug/ml]

Western Blot analysis of EIF2AK2 expression in transfected 293T cell line by EIF2AK2 monoclonal antibody (M02), clone 1D11. Lane 1: EIF2AK2 transfected lysate (62.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).