EHMT2 antibody

• Catalog Number: orb574235
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EHMT2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ChIP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EHMT2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 132kDa
• Target: EHMT2
• UniProt ID: Q96KQ7
• Protein Sequence: Synthetic peptide located within the following region: VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG
• NCBI: NP_006700
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: G9A, BAT8, GAT8, NG36, KMT1C, C6orf30
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

WB Suggested Anti-EHMT2 Antibody, Positive Control: Lane 1: 30 ug human RKO lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondry Antibody Dilution: 1:5000.

WB Suggested Anti-EHMT2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.