EFNB1 antibody

• Catalog Number: orb579792
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EFNB1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EFNB1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38 kDa
• Target: EFNB1
• UniProt ID: P98172
• Protein Sequence: Synthetic peptide located within the following region: SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG
• NCBI: NP_004420
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CFND, CFNS, EFB1, EFL3, EPLG2, Elk-L, LERK2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Ephrin-B1 is a 38 kDa protein processed into a 35 kDa form. Recommended dilution for this antibody is 1-3 ug/ml.

Host: Mouse, Target Name: EFNB1, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: EFNB1, Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: EFNB1, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target: EFNB1, Positive control (+): Human Placenta (PL), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

WB Suggested Anti-EFNB1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human kidney.