You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580330 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EEF1A2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EEF1A2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 50 kDa |
Target | EEF1A2 |
UniProt ID | Q05639 |
Protein Sequence | Synthetic peptide located within the following region: VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP |
NCBI | NP_001949 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HS1, STN, EF1A, STNL, DEE33, MRD38, EEF1AL, EIEE33 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by methylation, acteylation, phosphorylation and/or lipidation.
Host: Rabbit, Target Name: EEF1A2, Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: EEF1A2, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target: EEF1A2, Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Lung (LU), Antibody concentration: 1 ug/ml.
WB Suggested Anti-EEF1A2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human brain.
WB Suggested Anti-EEF1A2 antibody Titration: 1 ug/ml, Sample Type: Human HepG2.
ELISA, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating