You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580310 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EEF1A1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human EEF1A1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 50kDa |
Target | EEF1A1 |
UniProt ID | P68104 |
Protein Sequence | Synthetic peptide located within the following region: IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK |
NCBI | NP_001393 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CCS3, EF1A, PTI1, CCS-3, EE1A1, EEF-1, EEF1A, EF-T Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: EEF1A1, Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.
WB Suggested Anti-EEF1A1 antibody Titration: 1 ug/ml, Sample Type: Human Hela.
WB Suggested Anti-EEF1A1 antibody Titration: 1 ug/ml, Sample Type: Human HepG2.
WB Suggested Anti-EEF1A1 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate. EEF1A1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Bovine, Gallus, Hamster, Mouse, Rabbit, Rat, Xenopus, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Bovine, C. elegans, Drosophila, Gallus, Hamster, Mouse, Rabbit, Rat, Xenopus, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Equine, Hamster, Mouse, Other, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating