You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329980 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EED |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EED |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 45kDa |
Target | EED |
UniProt ID | O75530 |
Protein Sequence | Synthetic peptide located within the following region: QKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGK |
NCBI | NP_694536 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HEED antibody, anti WAIT1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human HepG3 tissue using EED antibody
Western blot analysis of HepG2 tissue using EED antibody
Host: Mouse, Target Name: EED, Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/mL.
Host: Rabbit, Target Name: EED, Sample Type: HepG2 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: EED, Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 4.0 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.
ICC, IF, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, WB | |
Bovine, Gallus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating