EED antibody

• Catalog Number: orb329845
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EED
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EED
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: EED
• UniProt ID: O75530
• Protein Sequence: Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC
• NCBI: NP_003788
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HEED antibody, anti WAIT1 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Fetal Liver tissue using EED antibody

Western blot analysis of human Fetal Lung tissue using EED antibody

Western blot analysis of human Fetal Heart tissue using EED antibody

Western blot analysis of OVCAR-3 cell lysate tissue using EED antibody

Immunofluorescense analysis of rat Brain lysate using EED antibody

Western blot analysis of human Fetal Stomach tissue using EED antibody

Western blot analysis of human Fetal Muscle tissue using EED antibody

Host: Rabbit, Target Name: EED, Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: EED, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: EED, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: EED, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: EED, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: EED, Sample Type: Human Fetal Stomach, Antibody Dilution: 1.0 ug/mL.

Sample Type: Rat Brain lysate, Dilution: 1:500.

WB Suggested Anti-EED Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:2500, Positive Control: OVCAR-3 cell lysate, EED is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.