EDN2 antibody

• Catalog Number: orb581533
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EDN2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human EDN2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 20kDa
• Target: EDN2
• UniProt ID: P20800
• Protein Sequence: Synthetic peptide located within the following region: MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCS
• NCBI: NP_001947
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ET2, ET-2, PPET2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-EDN2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.