EDF1 antibody

• Catalog Number: orb576652
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EDF1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EDF1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 16kDa
• Target: EDF1
• UniProt ID: O60869
• Protein Sequence: Synthetic peptide located within the following region: INEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
• NCBI: NP_003783
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MBF1, EDF-1, CFAP280
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Prostate tissue at an antibody concentration of 5 ug/ml using anti-EDF1 antibody (orb576652).

Sample Type: Fibroblasts.

WB Suggested Anti-EDF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human brain.