EDAR antibody

• Catalog Number: orb580825
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EDAR
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EDAR
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48kDa
• Target: EDAR
• UniProt ID: Q9UNE0
• Protein Sequence: Synthetic peptide located within the following region: PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV
• NCBI: NP_071731
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DL, ED3, ED5, ED1R, EDA3, HRM1, EDA1R, ECTD10A, EC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: NOP56, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: NSUN6, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-EDAR Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.