You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb389428 |
---|---|
Category | Antibodies |
Description | EBP1/PA2G4 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 43787 MW |
UniProt ID | Q9UQ80 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Proliferation-associated protein 2G4;Cell cycle pr Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of EBP1 using anti-EBP1 antibody.Lane 1:rat liver tissue;2:NIH3T3 cell;3:HEPG2 cell.
IHC analysis of EBP1 using anti-EBP1 antibody. EBP1 was detected in paraffin-embedded section of mouse intestine tissues.
IHC analysis of EBP1 using anti-EBP1 antibody. EBP1 was detected in paraffin-embedded section of rat intestine tissues.
IHC analysis of EBP1 using anti-EBP1 antibody. EBP1 was detected in paraffin-embedded section of mouse brain tissues.
FC, ICC, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Recombinant | |
Unconjugated |
Filter by Rating