You have no items in your shopping cart.
Cart summary
E6 Recombinant Protein
Catalog Number: orb2056279
| Catalog Number | orb2056279 |
|---|---|
| Category | Proteins |
| Description | E6 Recombinant Protein |
| Species/Host | Virus |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 21.2 kDa |
| UniProt ID | P03126 |
| Protein Sequence | MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL |
| Source | Yeast |
| NCBI | NP_041325.1 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | HpV16gp1;protein E6*;transforming protein E6. Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human E6 Protein [orb1477298]
Greater than 85% as determined by SDS-PAGE.
24.5 kDa
E.coli
20 μg, 100 μg, 1 mgVACWR062 Protein [orb1477830]
Greater than 90% as determined by SDS-PAGE.
42.7 kDa
E.coli
20 μg, 100 μg, 1 mgHuman E6 protein [orb246127]
Greater than 90% as determined by SDS-PAGE.
21.2 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgHuman E6 protein [orb244766]
Greater than 90% as determined by SDS-PAGE.
23.2 kDa
E.coli
20 μg, 100 μg, 1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
