You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2056277 |
---|---|
Category | Proteins |
Description | E6 Recombinant Protein |
Species/Host | Virus |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 21.2 kDa |
UniProt ID | P03126 |
Protein Sequence | MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL |
Source | Yeast |
NCBI | NP_041325.1 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | HpV16gp1;protein E6*;transforming protein E6. Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 85% as determined by SDS-PAGE. | |
24.5 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
42.7 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
21.2 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
23.2 kDa | |
E.coli |
Filter by Rating