E2F7 antibody

• Catalog Number: orb329926
• Category: Antibodies
• Description: Rabbit polyclonal antibody to E2F7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse E2F7
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 100 kDa
• Target: E2F7
• UniProt ID: Q6S7F2
• Protein Sequence: Synthetic peptide located within the following region: LFRPIENKEDAFVNSLQLDVAGDGAVDEYEKQRPSRKQKSLGLLCQKFLA
• NCBI: NP_848724
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti D10Ertd739e antibody, anti A630014C11Rik anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 49 kDa.

WB Suggested Anti-E2F7 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.