You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329925 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to E2f7 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse E2f7 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 99kDa |
Target | E2f7 |
UniProt ID | Q8BSQ3 |
Protein Sequence | Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE |
NCBI | NP_848724 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti A630014C11Rik antibody, anti D10Ertd739e anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Note this peptide is 85% identical to the human E2F7 sequence. A 76 kDa isoform also has an 85% match to this sequence.
Host: Rabbit, Target Name: E2f7, Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.
Host: Rabbit, Target Name: E2F7, Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.
Host: Rabbit, Target Name: E2f7, Sample Tissue: NIH-3T3, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: E2F7, Sample Type: SP2/0 Whole Cell lysates, Antibody Dilution: 0.05 ug/mL.
Mouse stomach
WB Suggested Anti-E2f7 Antibody Titration: 0.2-1 ug/mL, Positive Control: SP2/0 cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating