E2F3 antibody

• Catalog Number: orb576521
• Category: Antibodies
• Description: Rabbit polyclonal antibody to E2F3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human E2F3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 49 kDa
• Target: E2F3
• UniProt ID: Q68DT0
• Protein Sequence: Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK
• NCBI: CAH18140
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: E2F-3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is also present in isoforms of 42 kDa and 37 kDa.

Host: Mouse, Target Name: E2F3, Sample Tissue: Mouse Small Intestine, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: E2F3, Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: E2F3, Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: E2F3, Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 0.5 ug/ml.

Host: Rabbit, Target Name: E2F3, Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-E2F3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Thymus.