You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
E. coli FIMH protein
Catalog Number: orb418828
| Catalog Number | orb418828 |
|---|---|
| Category | Proteins |
| Description | Recombinant Escherichia coli FimH |
| Tag | Tag-Free |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 29.1 kDa |
| UniProt ID | P08191 |
| Protein Sequence | FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ |
| Protein Length | Full Length of Mature Protein |
| Source | Yeast |
| Biological Origin | Escherichia coli (strain K12) |
| Expression Region | 22-300aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | fimH, b4320, JW4283Type 1 fimbrin D-mannose specif Read more... |
| Note | For research use only |
| Application notes | Tag Info: NO-taggedExpression Region: 22-300aaSequence Info: Full Length |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Escherichia coli (strain K12) fimH.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Escherichia coli (strain K12) fimH.
- Item 1 of 3
E. coli fimH protein [orb244754]
Greater than 90% as determined by SDS-PAGE.
59.1 kDa
E.coli
100 μg, 1 mg, 20 μg - Item 1 of 3
E. coli fimH protein [orb604781]
Greater than 85% as determined by SDS-PAGE.
33.1 kDa
E.coli
100 μg, 1 mg, 20 μg - Item 1 of 1
E. coli fimH protein [orb246117]
Greater than 90% as determined by SDS-PAGE.
31.1 kDa
Yeast
20 μg, 100 μg, 1 mg - Item 1 of 1
E. coli fimH protein [orb604782]
Greater than 85% as determined by SDS-PAGE.
29.8 kDa
E.coli
20 μg, 100 μg, 1 mg 
FimH Protein, E. coli, Recombinant (Yeast, His) [orb1979166]
98.00%
31.1 kDa (predicted)
1 mg, 100 μg, 20 μg
