You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb389434 |
---|---|
Category | Antibodies |
Description | DR4/TNFRSF10A Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human DR4 (99-131aa VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry, 0.5-1μg/mlWestern blot, 0.1-0.5μg/mlFlow Cytometry, 1-3μg/1x106cells |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 50089 MW |
UniProt ID | O00220 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Tumor necrosis factor receptor superfamily member Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of A549 cells using anti-DR4 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of DR4 using anti-DR4 antibody.Lane 1:rat spleen tissue;2:mouse spleen tissue;3:MCF-7 cell.
IF analysis of ATG14L using anti-ATG14L antibody. ATG14L was detected in an immunocytochemical section of U2OS cells.
Filter by Rating