You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581515 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DPYSL2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IP, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Zebrafish |
Reactivity | Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DPYSL2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 62kDa |
Target | DPYSL2 |
UniProt ID | Q16555 |
Protein Sequence | Synthetic peptide located within the following region: NIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKR |
NCBI | NP_001377 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | DRP2, N2A3, CRMP2, DRP-2, ULIP2, CRMP-2, DHPRP2, U Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Amount and Sample Type: 500 ug rat brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: DPYSL2, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: DPYSL2.
WB Suggested Anti-DPYSL2 Antibody, Positive Control: lane 1: 80 ug mouse brain extract, Primary Antibody Dilution: 1:500, Secondary Antibody: IRDye 800 CW goat anti-rabbit, Secondry Antibody Dilution: 1:20000.
WB Suggested Anti-DPYSL2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human brain.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating