You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579694 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DPP3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DPP3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 82kDa |
Target | DPP3 |
UniProt ID | Q9NY33 |
Protein Sequence | Synthetic peptide located within the following region: SRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEE |
NCBI | NP_005691 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | DPPIII Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: DPP3, Sample Type: Hela, Antibody dilution: 1.0 ug/ml. DPP3 is supported by BioGPS gene expression data to be expressed in HeLa.
Host: Rabbit, Target Name: DPP3, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. DPP3 is supported by BioGPS gene expression data to be expressed in 721_B.
Host: Rabbit, Target Name: DPP3, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. DPP3 is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-DPP3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. DPP3 is supported by BioGPS gene expression data to be expressed in Jurkat.
Filter by Rating