You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586412 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DPAGT1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human DPAGT1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 33kDa |
Target | DPAGT1 |
UniProt ID | Q9H3H5 |
Protein Sequence | Synthetic peptide located within the following region: TKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLG |
NCBI | NP_001373 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GPT, ALG7, DGPT, G1PT, UAGT, UGAT, CDG1J, CMS13, D Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: DPAGT1, Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: DPAGT1, Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. DPAGT1 is supported by BioGPS gene expression data to be expressed in HepG2.
Host: Rabbit, Target Name: DPAGT1, Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. DPAGT1 is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-DPAGT1 Antibody, Titration: 1.0 ug/ml, Positive Control: PANC1 Whole Cell. DPAGT1 is supported by BioGPS gene expression data to be expressed in PANC1.
ELISA, IF, IHC-P, WB | |
Bovine | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating