Doublecortin antibody

• Catalog Number: orb578005
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Doublecortin
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DCX
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: DCX
• UniProt ID: O43602
• Protein Sequence: Synthetic peptide located within the following region: PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR
• NCBI: NP_835365
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DC, DBCN, LISX, SCLH, XLIS
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of Mouse spinal cord using Doublecortin antibody.

Western blot analysis of HepG2 cell lysate using Doublecortin antibody.

Sample Type: Mouse spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-Alexa 594, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Red: DCX Blue:DAPI, Gene Name: DCX.

WB Suggested Anti-DCX Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.