You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581671 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DNM1L |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DNM1L |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 82 kDa |
Target | DNM1L |
UniProt ID | O00429 |
Protein Sequence | Synthetic peptide located within the following region: IRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVG |
NCBI | NP_036192 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | DLP1, DRP1, DVLP, EMPF, OPA5, EMPF1, DYMPLE, HDYNI Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Isoforms containing the peptide sequence are present at ~79-80 kDa.
Host: Rabbit, Target Name: DNM1L, Sample Tissue: Human DLD1 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: DNM1L, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target: DNM1L, Positive control (+): A549 (N03), Negative control (-): HepG2 (HG), Antibody concentration: 3 ug/ml.
Application: IHC, Species+tissue/cell type: Mouse brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.
WB Suggested Anti-DNM1L Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate. DNM1L is supported by BioGPS gene expression data to be expressed in HeLa.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating