DNASE1 Rabbit Polyclonal Antibody

• Catalog Number: orb330488
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DNASE1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DNASE1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 31kDa
• Target: DNASE1
• UniProt ID: P24855
• Protein Sequence: Synthetic peptide located within the following region: GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD
• NCBI: NP_005214
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp686H0155 antibody, anti DNL1 antibody, a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Lung Tumor, Antibody Dilution: 1.0 ug/mL.

Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Liver (LI), Antibody concentration: 3 ug/mL.

WB Suggested Anti-DNASE1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: PANC1 cell lysate, DNASE1 is supported by BioGPS gene expression data to be expressed in PANC1.