You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580669 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DNA Polymerase theta |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human POLQ |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 290 kDa |
Target | POLQ |
UniProt ID | O75417 |
Protein Sequence | Synthetic peptide located within the following region: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL |
NCBI | NP_955452.3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PRO0327 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. Several high molecular weight isoforms contain this peptide sequence including 290 kDa, 198 kDa, and 129.
Host: Rabbit, Target Name: POLQ, Sample Tissue: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: POLQ, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: POLQ, Sample Tissue: Human Thyroid, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target: POLQ, Positive control (+): Human Placenta (PL), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.
POLQ (polymerase (DNA directed), theta) Antibody (against the C terminal of POLQ) (50 ug) validated by WB using Placenta Lysate at 0.2-1 ug/ml.
ICC, IF, IHC-P, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating