DLX3 monoclonal antibody (M02), clone 3B8

• Catalog Number: orb2293577
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant DLX3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B8
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: DLX3 (AAH12361, 1 a.a. ~ 287 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY
• NCBI: AAH12361
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged DLX3 is approximately 0.3 ng/ml as a capture antibody.

DLX3 monoclonal antibody (M02), clone 3B8 Western Blot analysis of DLX3 expression in A-549.

Western Blot analysis of DLX3 expression in transfected 293T cell line by DLX3 monoclonal antibody (M02), clone 3B8. Lane 1: DLX3 transfected lysate (31.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (57.31 KDa).