DLX3 antibody

• Catalog Number: orb576749
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DLX3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep, Yeast
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DLX3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32kDa
• Target: DLX3
• UniProt ID: O60479
• Protein Sequence: Synthetic peptide located within the following region: SASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY
• NCBI: NP_005211
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AI4, TDO
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: DLX3, Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target: DLX3, Positive control (+): MCF7 (N10), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.

WB Suggested Anti-DLX3 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: Transfected 293T.