DLL1 antibody

• Catalog Number: orb330489
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DLL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Mouse, Porcine, Rabbit
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DLL1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 78 kDa
• Target: DLL1
• UniProt ID: O00548
• Protein Sequence: Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
• NCBI: NP_005609
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DELTA1 antibody, anti Delta antibody, anti DL
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.

Anti-DLL1 antibody IHC of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Anti-DLL1 antibody IHC of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Host: Rabbit, Target Name: DLL1, Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: DLL1, Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: DLL1, Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Host: Rabbit, Target: DLL1, Positive control (+): Mouse spleen (M-SP), Negative control (-): Mouse intestine (M-IN), Antibody concentration: 1 ug/mL.

Host: Rat, Target Name: DLL1, Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-DLL1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.