You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578300 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DLAT |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DLAT |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 69 kDa |
Target | DLAT |
UniProt ID | P10515 |
Protein Sequence | Synthetic peptide located within the following region: WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR |
NCBI | NP_001922 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | E2, PBC, DLTA, PDCE2, PDC-E2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Huh7 lysate (50 ug), Primary Antibody Dilution: 1:200.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms are present from ~68 kDa to ~ 55 kDa.
Host: Rabbit, Target Name: DLAT, Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target: DLAT, Positive control (+): HepG2 (HG), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.
Rabbit Anti-DLAT Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-DLAT Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating