DKK1 monoclonal antibody (M11), clone 2A5

• Catalog Number: orb2291377
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant DKK1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2A5
• Tested applications: ELISA, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: DKK1 (AAH01539.1, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MMALGAAGATRVSVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTTGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKGGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
• NCBI: AAH01539.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged DKK1 is 0.1 ng/ml as a capture antibody.

DKK1 monoclonal antibody (M11), clone 2A5 Western Blot analysis of DKK1 expression in U-2 OS.

Immunoperoxidase of monoclonal antibody to DKK1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Immunoprecipitation of DKK1 transfected lysate using anti-DKK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DKK1 MaxPab rabbit polyclonal antibody.