You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291377 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant DKK1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2A5 |
Tested applications | ELISA, IHC-P, IP, WB |
Reactivity | Human |
Isotype | IgG2b Kappa |
Immunogen | DKK1 (AAH01539.1, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MMALGAAGATRVSVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTTGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKGGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
NCBI | AAH01539.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged DKK1 is 0.1 ng/ml as a capture antibody.
DKK1 monoclonal antibody (M11), clone 2A5 Western Blot analysis of DKK1 expression in U-2 OS.
Immunoperoxidase of monoclonal antibody to DKK1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Immunoprecipitation of DKK1 transfected lysate using anti-DKK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DKK1 MaxPab rabbit polyclonal antibody.