You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291379 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant DKK1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4D4 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG2b Kappa |
Immunogen | DKK1 (NP_036374, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | QPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH |
NCBI | NP_036374 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
DKK1 monoclonal antibody (M01), clone 4D4 Western Blot analysis of DKK1 expression in HepG2.
DKK1 monoclonal antibody (M01), clone 4D4. Western Blot analysis of DKK1 expression in Jurkat.
Western Blot detection against Immunogen (36.74 KDa).