DKK1 antibody

• Catalog Number: orb580252
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DKK1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DKK1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29 kDa
• Target: DKK1
• UniProt ID: O94907
• Protein Sequence: Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD
• NCBI: NP_036374
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SK, DKK-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2.5 ug/ml of the antibody was used in this experiment.

Lanes: Lane 1: 30 ug human PLC/PRF5 cell lysate, Lane 2: 30 ug DKK1 PLC/PRF5 cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP Anti-rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: DKK1 a.

WB Suggested Anti-DKK1 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.