You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575921 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DHX9 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC-P, WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DHX9 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 141kDa |
Target | DHX9 |
UniProt ID | Q08211 |
Protein Sequence | Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK |
NCBI | NP_001348 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | LKP, RHA, DDX9, NDH2, NDHII Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
DHX9 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb575921 with 1:200 dilution. Western blot was performed using orb575921 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: DHX9 IP with orb575921 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.
Human Pancreas
WB Suggested Anti-DHX9 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating