DHX9 antibody

• Catalog Number: orb575921
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DHX9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DHX9
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 141kDa
• Target: DHX9
• UniProt ID: Q08211
• Protein Sequence: Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
• NCBI: NP_001348
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LKP, RHA, DDX9, NDH2, NDHII
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

DHX9 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb575921 with 1:200 dilution. Western blot was performed using orb575921 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: DHX9 IP with orb575921 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

Human Pancreas

WB Suggested Anti-DHX9 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.