Cart summary

You have no items in your shopping cart.

    DHX15/prp43 Antibody

    Catalog Number: orb614111

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb614111
    CategoryAntibodies
    DescriptionDHX15/prp43 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human DHX15/prp43 (DIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW91 kDa
    UniProt IDO43143
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesPre-mRNA-splicing factor ATP-dependent RNA helicas
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    DHX15/prp43 Antibody

    WB analysis using anti-DHX15/prp43 antibody.Lane 1:HeLa cell, Lane 2:293T cell, Lane 3:RT4 cell.

    DHX15/prp43 Antibody

    IF analysis of DHX15/prp43 using anti-DHX15/prp43 antibody.

    DHX15/prp43 Antibody

    Flow Cytometry analysis of Ana-1 cells using anti-DHX15 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.

    DHX15/prp43 Antibody

    Flow Cytometry analysis of A431 cells using anti-DHX15 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.

    DHX15/prp43 Antibody

    IHC analysis of DHX15 using anti-DHX15 antibody.

    DHX15/prp43 Antibody

    IHC analysis of DHX15 using anti-DHX15 antibody.

    DHX15/prp43 Antibody

    IHC analysis of DHX15 using anti-DHX15 antibody.

    DHX15/prp43 Antibody

    IHC analysis of DHX15 using anti-DHX15 antibody.

    DHX15/prp43 Antibody

    IHC analysis of DHX15 using anti-DHX15 antibody.

    DHX15/prp43 Antibody

    IHC analysis of DHX15 using anti-DHX15 antibody.

    DHX15/prp43 Antibody

    IHC analysis of DHX15 using anti-DHX15 antibody.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars