Dgat2 antibody

• Catalog Number: orb330605
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Dgat2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat
• Reactivity: Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 44 kDa
• Target: Dgat2
• UniProt ID: Q9DCV3
• Protein Sequence: Synthetic peptide located within the following region: LMSGGICPVNRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLK
• NCBI: NP_080660
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 0610010B06Rik antibody, anti DGAT-2 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Two smaller isoforms may be detected in some tissues or cell lines.

WB Suggested Anti-Dgat2 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.