You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330605 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Dgat2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat |
Reactivity | Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 44 kDa |
Target | Dgat2 |
UniProt ID | Q9DCV3 |
Protein Sequence | Synthetic peptide located within the following region: LMSGGICPVNRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLK |
NCBI | NP_080660 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti 0610010B06Rik antibody, anti DGAT-2 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Two smaller isoforms may be detected in some tissues or cell lines.
WB Suggested Anti-Dgat2 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.
EIA, ELISA, FC, IHC | |
Canine, Mouse, Rat | |
Human | |
Goat | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating