DEF6 antibody

• Catalog Number: orb331309
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DEF6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human BRCC3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41kDa
• Target: BRCC3
• UniProt ID: P46736
• Protein Sequence: Synthetic peptide located within the following region: QERYIERAQQEKEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAA
• NCBI: NP_001018065.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: C6.1A, BRCC36, CXorf53
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human 293T tissue using DEF6 antibody

Host: Rabbit, Target Name: DEF6, Sample Type: 293T Whole Cell lysates, Antibody dilution: 1.0 ug/ml.