DDX39A antibody

• Catalog Number: orb329870
• Category: Antibodies
• Description: Rabbit polyclonal antibody to DDX39A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDX39
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: DDX39A
• UniProt ID: O00148
• Protein Sequence: Synthetic peptide located within the following region: MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFL
• NCBI: NP_005795
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti BAT1 antibody, anti DDXL antibody, anti BAT1L
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-DDX39 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, DDX39A is supported by BioGPS gene expression data to be expressed in HepG2.