You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb443173 |
---|---|
Category | Antibodies |
Description | DDT Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human DDT (EFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 14 kDa |
UniProt ID | P30046 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | D-dopachrome decarboxylase; D-dopachrome tautomera Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U20S cells using anti-DDT antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of DDT using anti-DDT antibody.Lane 1:human HL-60 Cell;2:rat liver tissue;3:mouse liver tissue.
IF analysis of DDT using anti-DDT antibody. DDT was detected in immunocytochemical section of U20S cells.
IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human cholangiocarcinoma tissue.
IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human lung cancer tissue.
IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human placenta tissue.
IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human ovary cancer tissue.
IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of rat brain tissue.
IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of rat spleen tissue.
IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human tonsil tissue.
IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of mouse spleen tissue.
IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of mouse small intestine tissue.
IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating