Cart summary

You have no items in your shopping cart.

    DDT Antibody

    Catalog Number: orb443173

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb443173
    CategoryAntibodies
    DescriptionDDT Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsIHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human DDT (EFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW14 kDa
    UniProt IDP30046
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesD-dopachrome decarboxylase; D-dopachrome tautomera
    Read more...
    NoteFor research use only
    Application notesAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    DDT Antibody

    Flow Cytometry analysis of U20S cells using anti-DDT antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    DDT Antibody

    WB analysis of DDT using anti-DDT antibody.Lane 1:human HL-60 Cell;2:rat liver tissue;3:mouse liver tissue.

    DDT Antibody

    IF analysis of DDT using anti-DDT antibody. DDT was detected in immunocytochemical section of U20S cells.

    DDT Antibody

    IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human cholangiocarcinoma tissue.

    DDT Antibody

    IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human intestinal cancer tissue.

    DDT Antibody

    IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human lung cancer tissue.

    DDT Antibody

    IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human placenta tissue.

    DDT Antibody

    IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human ovary cancer tissue.

    DDT Antibody

    IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of rat brain tissue.

    DDT Antibody

    IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of rat spleen tissue.

    DDT Antibody

    IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human tonsil tissue.

    DDT Antibody

    IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of mouse spleen tissue.

    DDT Antibody

    IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of mouse small intestine tissue.

    • DDT antibody [orb555986]

      IHC-P,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • DDT antibody [orb676373]

      ELISA,  IHC

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μg, 50 μg
    • DDT antibody [orb69975]

      IHC,  WB

      Human

      Rabbit

      Recombinant

      Unconjugated

      100 μl
    • DDT antibody [orb771515]

      ELISA,  IHC-P

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100ul, 50ul
    • D-dopachrome decarboxylase DDT Antibody [orb27669]

      IHC,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      10 μg, 100 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars