You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579402 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Dct |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep |
Reactivity | Mouse, Zebrafish |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 59 kDa |
Target | Dct |
UniProt ID | Q6NXI2 |
Protein Sequence | Synthetic peptide located within the following region: QHWLGLLGPNGTQPQIANCSVYDFFVWLHYYSVRDTLLGPGRPYKAIDFS |
NCBI | NP_034154 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | DT, TR, TRP, Tyr, slt, TRP2, Tyrp, TRP-2, Tyrp2, s Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Host: Mouse, Target Name: DCT, Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.
Sample Type: Zebrafish embryo section, Primary Antibody Dilution: 1:50, Secondary Antibody: Anti-rabbit-Alexa Fluor 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: DCT, Gene Name: Dct.
WB Suggested Anti-Dct Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Mouse Heart.
IHC-P, WB | |
Bovine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating