You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402224 |
---|---|
Category | Antibodies |
Description | DC-SIGN/CD209 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, IHC, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 46 kDa |
UniProt ID | Q9NNX6 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | CD209 antigen; C-type lectin domain family 4 membe Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of THP-1 cells using anti-DC-SIGN antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of DC-SIGN using anti-DC-SIGN antibody.Lane 1:human HepG2 cell.
IHC analysis of DC-SIGN using anti-DC-SIGN antibody.DC-SIGN was detected in paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of DC-SIGN using anti-DC-SIGN antibody.DC-SIGN was detected in paraffin-embedded section of human placenta tissue.
ELISA, FA, FACS, Kinetics | |
Human | |
Monoclonal | |
Unconjugated |
ELISA, FA, FACS, Kinetics | |
Human | |
Monoclonal | |
Unconjugated |
Filter by Rating