You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581529 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to DBT |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DBT |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 46kDa |
Target | DBT |
UniProt ID | P11182 |
Protein Sequence | Synthetic peptide located within the following region: NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW |
NCBI | NP_001909 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | E2, E2B, BCATE2, BCKADE2, BCKAD-E2, BCKDH-E2, BCOA Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: DBT, Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 0.5 ug/ml.
Host: Rabbit, Target: DBT, Positive control (+): Human Liver (LI), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 1 ug/ml.
Immunohistochemistry of formalin-fixed, paraffin-embedded human kidney tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry of formalin-fixed, paraffin-embedded human skin tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry of formalin-fixed, paraffin-embedded human spleen tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
WB Suggested Anti-DBT Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate. There is BioGPS gene expression data showing that DBT is expressed in HT1080.
Filter by Rating