Cart summary

You have no items in your shopping cart.

    DARPP32/PPP1R1B Antibody

    Catalog Number: orb334612

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb334612
    CategoryAntibodies
    DescriptionDARPP32/PPP1R1B Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, IHC, WB
    Predicted ReactivityGallus
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW22963 MW
    UniProt IDQ9UD71
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesProtein phosphatase 1 regulatory subunit 1B;DARPP-
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    DARPP32/PPP1R1B Antibody

    Flow Cytometry analysis of THP-1 cells using anti-DARPP32 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    DARPP32/PPP1R1B Antibody

    Flow Cytometry analysis of PC-3 cells using anti-DARPP32 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    DARPP32/PPP1R1B Antibody

    WB analysis of DARPP32 using anti-DARPP32 antibody.Lane 1:human CACO-2 cell; 2:rat brain tissue; 3:mouse brain tissue.

    DARPP32/PPP1R1B Antibody

    IHC analysis of DARPP32 using anti-DARPP32 antibody. DARPP32 was detected in a paraffin-embedded section of mouse pancreas tissue.

    DARPP32/PPP1R1B Antibody

    IHC analysis of DARPP32 using anti-DARPP32 antibody. DARPP32 was detected in a paraffin-embedded section of rat intestine tissue.

    DARPP32/PPP1R1B Antibody

    IHC analysis of DARPP32 using anti-DARPP32 antibody. DARPP32 was detected in a paraffin-embedded section of human lung cancer tissue.

    • DARPP32 PPP1R1B Rabbit Monoclonal Antibody [orb548204]

      ICC,  IF,  IHC,  IP,  WB

      Human, Mouse, Rat

      Rabbit

      Monoclonal

      Unconjugated

      30 μl, 100 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars