You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334612 |
---|---|
Category | Antibodies |
Description | DARPP32/PPP1R1B Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, IHC, WB |
Predicted Reactivity | Gallus |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 22963 MW |
UniProt ID | Q9UD71 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Protein phosphatase 1 regulatory subunit 1B;DARPP- Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of THP-1 cells using anti-DARPP32 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of PC-3 cells using anti-DARPP32 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of DARPP32 using anti-DARPP32 antibody.Lane 1:human CACO-2 cell; 2:rat brain tissue; 3:mouse brain tissue.
IHC analysis of DARPP32 using anti-DARPP32 antibody. DARPP32 was detected in a paraffin-embedded section of mouse pancreas tissue.
IHC analysis of DARPP32 using anti-DARPP32 antibody. DARPP32 was detected in a paraffin-embedded section of rat intestine tissue.
IHC analysis of DARPP32 using anti-DARPP32 antibody. DARPP32 was detected in a paraffin-embedded section of human lung cancer tissue.
ICC, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating