You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb316578 |
---|---|
Category | Antibodies |
Description | Cytokeratin 19/KRT19 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 44106 MW |
UniProt ID | P08727 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Keratin, type I cytoskeletal 19;Cytokeratin-19;CK- Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of MCF-7 cells using anti-Cytokeratin 19 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis using anti-Cytokeratin 19 antibody.Lane 1:human placenta tissue.2:human MCF-7 cell; 3:human SW620 cell; 4:human HepG2 cell; 5:human PANC-1 cell; 6:rat lung tissue; 7:rat small intestine tissue; 8:mouse lung tissue; 9:mouse HEPA1-6 cell.
IF analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody. Cytokeratin 19 was detected in immunocytochemical section of MCF-7 cells.
IF analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody. Cytokeratin 19 was detected in a paraffin-embedded section of human colon cancer tissue.
IHC analysis of KRT19 using anti-KRT19 antibody.KRT19 was detected in paraffin-embedded section of human lung cancer tissues.
IHC analysis of KRT19 using anti-KRT19 antibody.KRT19 was detected in paraffin-embedded section of human intestinal cancer tissues.
IHC analysis of KRT19 using anti-KRT19 antibody.KRT19 was detected in paraffin-embedded section of human lung cancer tissues.
IHC analysis of KRT19 using anti-KRT19 antibody.KRT19 was detected in paraffin-embedded section of rat small intestine tissues.
IHC analysis of KRT19 using anti-KRT19 antibody.KRT19 was detected in paraffin-embedded section of mouse small intestine tissues.
IHC analysis of KRT19 using anti-KRT19 antibody.KRT19 was detected in paraffin-embedded section of human lung cancer tissues.
FC, IF | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
FITC |
ICC, IHC-P, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
IF, IHC, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
ICC, IHC, WB | |
Monkey | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating