You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb421122 |
---|---|
Category | Antibodies |
Description | Cytokeratin 19 KRT19 Antibody (monoclonal, 3D4) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3D4 |
Tested applications | IF, IHC, WB |
Reactivity | Human |
Isotype | Mouse IgG1 |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 44 kDa |
UniProt ID | P08727 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Keratin, type I cytoskeletal 19; Cytokeratin-19; C Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human SK-OV-3 cell;4:human COLO-320 cell.
IF analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody.Cytokeratin 19 was detected in paraffin-embedded section of human intestinal cancer tissues.
IHC analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody.Cytokeratin 19 was detected in paraffin-embedded section of human intestinal cancer tissue.
Filter by Rating