Cart summary

You have no items in your shopping cart.

    Cytokeratin 19 KRT19 Antibody (monoclonal, 3D4)

    Catalog Number: orb421122

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb421122
    CategoryAntibodies
    DescriptionCytokeratin 19 KRT19 Antibody (monoclonal, 3D4)
    Species/HostMouse
    ClonalityMonoclonal
    Clone Number3D4
    Tested applicationsIF, IHC, WB
    ReactivityHuman
    IsotypeMouse IgG1
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW44 kDa
    UniProt IDP08727
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesKeratin, type I cytoskeletal 19; Cytokeratin-19; C
    Read more...
    NoteFor research use only
    Application notesAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Cytokeratin 19 KRT19 Antibody (monoclonal, 3D4)

    WB analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human SK-OV-3 cell;4:human COLO-320 cell.

    Cytokeratin 19 KRT19 Antibody (monoclonal, 3D4)

    IF analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody.Cytokeratin 19 was detected in paraffin-embedded section of human intestinal cancer tissues.

    Cytokeratin 19 KRT19 Antibody (monoclonal, 3D4)

    IHC analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody.Cytokeratin 19 was detected in paraffin-embedded section of human intestinal cancer tissue.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars