Cart summary

You have no items in your shopping cart.

    Cytochrome P450 Reductase/POR Antibody

    Catalog Number: orb316599

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb316599
    CategoryAntibodies
    DescriptionCytochrome P450 Reductase/POR Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW76690 MW
    UniProt IDP16435
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesNADPH--cytochrome P450 reductase;CPR;P450R;1.6.2.4
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Cytochrome P450 Reductase/POR Antibody

    Flow Cytometry analysis of K562 cells using anti-POR antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    Cytochrome P450 Reductase/POR Antibody

    Flow Cytometry analysis of A549 cells using anti-POR antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    Cytochrome P450 Reductase/POR Antibody

    Flow Cytometry analysis of SiHa cells using anti-POR antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    Cytochrome P450 Reductase/POR Antibody

    WB analysis of POR using anti-POR antibody.Lane 1:human placenta tissue; 2:human HepG2 cell; 3:human CACO-2 cell; 4:human K562 cell; 5:rat kidney tissue; 6:rat liver tissue; 7:mouse kidney tissue; 8:mouse liver tissue.

    Cytochrome P450 Reductase/POR Antibody

    IHC analysis of POR using anti-POR antibody. POR was detected in paraffin-embedded section of Human Mammary Cancer Tissue.

    Cytochrome P450 Reductase/POR Antibody

    IHC analysis of POR using anti-POR antibody. POR was detected in paraffin-embedded section of Rat Intestine Tissue.

    Cytochrome P450 Reductase/POR Antibody

    IHC analysis of POR using anti-POR antibody. POR was detected in paraffin-embedded section of Mouse Intestine Tissue.

    • Cytochrome P450 Reductase/POR Antibody [orb97078]

      FC,  ICC,  IHC,  WB

      Hamster

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      10 μg, 100 μg
    • Cytochrome P450 Reductase (POR) antibody [orb1325283]

      FC,  IF,  IHC,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μl
    • Cytochrome P450 Reductase (POR) antibody [orb1325302]

      IF,  IHC,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μl
    • Cytochrome P450 Reductase (POR) antibody [orb1325303]

      FC,  IF,  IHC,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μl
    • Cytochrome P450 Reductase (POR) antibody [orb1325304]

      FC,  IF,  IHC,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      100 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars