You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb381057 |
---|---|
Category | Antibodies |
Description | Cytochrome P450 3A4/CYP3A4 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human CYP3A4 (237-277aa NICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMID). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 57343 MW |
UniProt ID | P08684 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Cytochrome P450 3A4;1.14.13.-;1,8-cineole 2-exo-mo Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of CYP3A4 using anti-CYP3A4 antibody.Lane 1:HELA cell.
IHC analysis of CYP3A4 using anti-CYP3A4 antibody. CYP3A4 was detected in a paraffin-embedded section of human liver cancer tissue.
ELISA, FC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, IP, WB | |
Human | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating