You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581029 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CYTB |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human MT-CYB |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 43 kDa |
Target | CYTB |
UniProt ID | P00156 |
Protein Sequence | Synthetic peptide located within the following region: LFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLA |
NCBI | YP_003024038.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MTCYB Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: CYTB, Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: cytb, Sample Type: Fetal Liver lysates, Antibody dilution: 1.0 ug/ml.
Filter by Rating