You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578223 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CYP2B6 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CYP2B6 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56 kDa |
Target | CYP2B6 |
UniProt ID | P20813 |
Protein Sequence | Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL |
NCBI | NP_000758 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CPB6, EFVM, IIB1, P450, CYP2B, CYP2B7, CYP2B7P, CY Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 33 kDa.
Host: Mouse, Target Name: CYP2B10, Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-CYP2B6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: THP-1 cell lysate.
FC, ICC, IF, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating