CYP21A2 Rabbit Polyclonal Antibody

• Catalog Number: orb584587
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CYP21A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Porcine, Sheep
• Reactivity: Human, Monkey
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CYP21A2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: CYP21A2
• UniProt ID: Q16874
• Protein Sequence: Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA
• NCBI: NP_000491
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CAH1, CPS1, CA21H, CYP21, CYP21B, P450c21B
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Monkey adrenal gland, Primary Antibody dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Brown: CYP21A2 Blue: Nucleus, Gene Name: CYP21A2.

Sample Type: Monkey vagina, Primary Antibody dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Brown: CYP21A2 Blue: Nucleus, Gene Name: CYP21A2.

WB Suggested Anti-CYP21A2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.